PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.5G360500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 552aa    MW: 59573.2 Da    PI: 5.2166
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.5G360500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.51.1e-164390148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WT  Ed +lvd+vk++G g+W+++ +  g+ R++k+c++rw ++l
  Sevir.5G360500.1.p 43 KGPWTSAEDAILVDYVKKHGEGNWNAVQKNTGLFRCGKSCRLRWANHL 90
                        79******************************************9986 PP

2Myb_DNA-binding50.45.1e-1696139146
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         +g++T+eE+ l++++++++G++ W++ a+ ++ gRt++++k++w++
  Sevir.5G360500.1.p  96 KGAFTPEEERLIIQLHAKMGNK-WARMAANLP-GRTDNEIKNYWNT 139
                         799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0016931.1E-2491551IPR016310Transcription factor, GAMYB
PROSITE profilePS5129416.6253890IPR017930Myb domain
SuperFamilySSF466891.61E-3040137IPR009057Homeodomain-like
SMARTSM007172.1E-144292IPR001005SANT/Myb domain
PfamPF002491.1E-144390IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-234497IPR009057Homeodomain-like
CDDcd001672.67E-114590No hitNo description
PROSITE profilePS5129425.09791145IPR017930Myb domain
SMARTSM007177.6E-1795143IPR001005SANT/Myb domain
PfamPF002493.3E-1596139IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-2598143IPR009057Homeodomain-like
CDDcd001672.12E-1298139No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009789Biological Processpositive regulation of abscisic acid-activated signaling pathway
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 552 aa     Download sequence    Send to blast
MYRVKSESDC DMMLQDQMDS PVADDVSSGE GSPHRGSGPP LKKGPWTSAE DAILVDYVKK  60
HGEGNWNAVQ KNTGLFRCGK SCRLRWANHL RPNLKKGAFT PEEERLIIQL HAKMGNKWAR  120
MAANLPGRTD NEIKNYWNTR IKRCQRAGLP IYPASVCNQS SSEDQQVSGD FNCSENISND  180
LLSGNGLYLP DFTSDNFIAN PDALSYAPHL SAVSIGNLLG QSFASKNCSF MDQVDHSGML  240
KQSGCVLPAL SDTIDGVLSS VDQFSNGSEK LKQALGFDYL NEANASSKTI APFGVALSGS  300
HAFLNGNFSA SRPINGPLKR ELPSLQDTES DPNSWLKYTL APAMQPTELV DPYLHSPIAT  360
PSVKSECASP RNSGLLEELL HEAQGRSGKN RQPSVRSSSS SANTPCETTT VVSPEFDLCP  420
EYWDDHHSSF INECAPFSGY SFTESTPVSA ASPDIFQLSK ISPAQSPSMG SGEQAVEPRH  480
ESAGSPHREN LRPDALFSGN SADPSTFNNA IAILLGNDMN AECKPVLGGG ITFGSSSWSN  540
MPNACEISEF K*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-32391433106B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00490DAPTransfer from AT5G06100Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0339250.0BT033925.1 Zea mays full-length cDNA clone ZM_BFc0044D10 mRNA, complete cds.
GenBankBT0626920.0BT062692.1 Zea mays full-length cDNA clone ZM_BFb0334D20 mRNA, complete cds.
GenBankBT0638280.0BT063828.1 Zea mays full-length cDNA clone ZM_BFc0110K24 mRNA, complete cds.
GenBankHQ8587500.0HQ858750.1 Zea mays clone UT1459 MYBGA transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004970317.10.0PREDICTED: transcription factor GAMYB
SwissprotQ0JIC20.0GAM1_ORYSJ; Transcription factor GAMYB
TrEMBLK3XG870.0K3XG87_SETIT; Transcription factor
STRINGSi000907m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP39473664
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.32e-90myb domain protein 33